Chemical Barrier: Antimicrobial Peptides and Acid Mantle
Chemical barrier systems provide sophisticated molecular defense mechanisms that complement physical barriers through antimicrobial peptides, pH regulation, enzyme systems, and bioactive lipids that collectively prevent pathogen invasion and maintain cutaneous homeostasis. These biochemical defense networks demonstrate ancient evolutionary origins with modern molecular specificity that targets diverse microorganisms while preserving beneficial microbiota and supporting barrier function. Understanding chemical barrier mechanisms provides insights into antimicrobial resistance, inflammatory dermatoses, and therapeutic strategies for infectious skin diseases.
Medical school foundation reminder: Antimicrobial peptides represent fundamental immune effector molecules you learned in immunology: membrane-disrupting mechanisms, broad-spectrum activity, rapid action kinetics, and low resistance development. pH homeostasis demonstrates basic biochemistry principles: acid-base equilibria, enzyme activity regulation, protein stability, and microbial growth control creating hostile environments for pathogenic organisms.
The chemical barrier system requires integration of peptide synthesis, pH regulation, enzymatic pathways, lipid metabolism, and microbiome interactions to create effective antimicrobial environments. Key molecular components include defensins, cathelicidin (LL-37), dermcidin, S100 proteins, free fatty acids, and pH-regulating systems that coordinate chemical defense.
Clinical significance: Disrupted chemical barriers contribute to infectious susceptibilities: atopic dermatitis (reduced AMP expression), chronic wounds (elevated pH), diabetic infections (altered antimicrobial activity), and immunodeficiency disorders (defective AMP production). Molecular understanding guides antimicrobial therapeutics and barrier enhancement strategies.
Pathological correlations: Chemical barrier defects reflect underlying mechanisms: genetic AMP deficiencies (primary immunodeficiencies), inflammatory cytokine effects (AMP dysregulation), microbial biofilms (pH neutralization), and chronic disease states (metabolic barrier dysfunction).
Antimicrobial Peptide Families
Defensin Systems
Defensins constitute ancient antimicrobial peptides with conserved structural motifs that provide broad-spectrum antimicrobial activity through membrane disruption mechanisms.
β-Defensin Family in Skin:
Human β-Defensin-2 (HBD-2):
- Gene location: DEFB4A, chromosome 8p23.1
- Protein structure: 64 amino acids, ~7 kDa (mature peptide 41 amino acids)
- Disulfide bonds: Three intramolecular disulfide bridges
- Expression sites: Keratinocytes, sebaceous glands, eccrine ducts
- Molecular weight: ~4.3 kDa (mature form)
- Antimicrobial spectrum: Gram-positive bacteria, some Gram-negative, fungi
HBD-2 Structural Features:
- β-sheet structure: Antiparallel β-sheets with flexible loops
- Cationic charge: +6 net positive charge at physiological pH
- Amphipathic properties: Hydrophobic and cationic regions
- Membrane targeting: Preferential binding to bacterial membranes
- Stability: Resistant to proteolysis, stable at low pH
Human β-Defensin-3 (HBD-3):
- Gene symbol: DEFB103A, chromosome 8p23.1
- Peptide characteristics: 68 amino acids precursor, 45 amino acids mature
- Molecular weight: ~5.2 kDa (mature peptide)
- High activity: Most potent human β-defensin
- Expression pattern: Constitutive and inducible in keratinocytes
- Clinical significance: Reduced in atopic dermatitis
Additional β-Defensins:
Human β-Defensin-1 (HBD-1):
- Gene: DEFB1, chromosome 8p23.1, 36 amino acids mature
- Properties: Constitutively expressed, salt-sensitive activity
- Function: Antimicrobial activity against specific bacteria
- Expression: Widespread epithelial distribution
Human β-Defensin-4 (HBD-4):
- Gene: DEFB104A, 50 amino acids mature peptide
- Activity: Broad antimicrobial spectrum including antibiotic-resistant organisms
- Expression: Inducible in inflammatory conditions
- Clinical relevance: Potential therapeutic target
Cathelicidin: LL-37 System
Cathelicidin represents the sole human cathelicidin with multifunctional properties extending beyond antimicrobial activity to include immunomodulation and barrier regulation.
LL-37/hCAP18 Structure and Processing:
Gene and Protein Organization:
- Gene symbol: CAMP, chromosome 3p21.31
- Precursor protein: hCAP18 (170 amino acids, ~18 kDa)
- Signal peptide: Removes first 30 amino acids
- Cathelin domain: N-terminal domain (103 amino acids)
- Mature peptide: LL-37 (37 amino acids, ~4.5 kDa)
- Processing enzymes: Proteinase 3, elastase, gastricsin
LL-37 Molecular Properties:
- Amino acid sequence: [LL-37, 37 aa]
- Net charge: +6 at physiological pH
- α-helical structure: Amphipathic α-helix in membrane environments
- Hydrophobic moment: High amphipathicity facilitating membrane insertion
- Stability: Relatively stable against proteases
Expression and Regulation:
Cellular Sources:
- Keratinocytes: Major source, induced by inflammation/injury
- Sebaceous glands: Constitutive low-level expression
- Eccrine ducts: Moderate expression levels
- Neutrophils: Stored in specific granules
- Mast cells: Release upon degranulation
Transcriptional Regulation:
- NF-κB pathway: TNF-α, IL-1β-induced upregulation
- Vitamin D receptor: 1,25(OH)₂D₃-mediated induction
- TLR signaling: Pathogen-induced expression enhancement
- p63 transcription factor: Basal expression maintenance
- STAT3 pathway: Growth factor-mediated regulation
Antimicrobial Mechanisms:
Membrane Disruption:
- Initial binding: Electrostatic attraction to negative bacterial membranes
- Membrane insertion: Hydrophobic regions integrate into lipid bilayer
- Pore formation: Oligomerization creates membrane-spanning pores
- Cell death: Loss of membrane integrity, osmotic lysis
- Selectivity: Preferential targeting of bacterial vs mammalian membranes
Immunomodulatory Functions:
- Chemotactic activity: Attracts neutrophils, monocytes, T cells
- Mast cell activation: Degranulation and cytokine release
- Dendritic cell maturation: Enhanced antigen presentation
- Wound healing: Promotes angiogenesis and epithelialization
- Clinical relevance: Dysregulated in rosacea, psoriasis
Loading diagram...
Specialized Antimicrobial Systems
Dermcidin: Sweat-Derived Protection
Dermcidin provides unique antimicrobial protection through eccrine sweat secretion with properties optimized for acidic skin conditions.
Dermcidin Structure and Function:
Gene and Protein Organization:
- Gene symbol: DCD, chromosome 12q13.12
- Precursor protein: 110 amino acids, ~12 kDa
- Signal peptide: 19 amino acid N-terminal sequence
- Mature peptides: DCD-1 (47 amino acids, ~4.7 kDa), DCD-1L (48 amino acids)
- Processing: Unknown specific enzymes
- Secretion: Constitutive via eccrine sweat glands
Unique Properties:
- Anionic peptide: Negative net charge (-2) at physiological pH
- Zinc-dependent: Requires zinc for antimicrobial activity
- pH optimum: Active at acidic pH (5.5-6.5)
- Proteolytic resistance: Stable against skin proteases
- Broad spectrum: Active against bacteria and fungi
Antimicrobial Mechanism:
- Zinc coordination: Forms multimeric complexes with zinc ions
- Membrane insertion: Zinc-mediated membrane targeting
- Channel formation: Creates voltage-gated membrane channels
- Cell death: Membrane depolarization and osmotic imbalance
- Selectivity: Enhanced activity in acidic sweat environment
S100 Protein Family
S100 proteins provide calcium-dependent antimicrobial activity with additional roles in inflammation and barrier regulation.
S100A7 (Psoriasin):
- Gene location: S100A7, chromosome 1q21.3
- Protein structure: 101 amino acids, ~11 kDa
- Calcium binding: EF-hand calcium-binding domains
- Expression: High in psoriatic epidermis, inflammatory conditions
- Antimicrobial activity: Particularly effective against E. coli
- Zinc dependence: Requires zinc for optimal activity
S100A8/S100A9 (Calprotectin):
- Gene symbols: S100A8 (1q21.3), S100A9 (1q21.3)
- Heterodimer: S100A8 (93 aa, ~10 kDa) + S100A9 (114 aa, ~13 kDa)
- Total complex: ~24 kDa calprotectin heterodimer
- Function: Metal sequestration antimicrobial mechanism
- Expression: Neutrophils, keratinocytes in inflammation
- Clinical marker: Elevated in inflammatory skin diseases
S100A12 (Calgranulins):
- Chromosomal location: 1q21.3, 92 amino acids
- Molecular weight: ~10 kDa
- Activity: Antimicrobial and pro-inflammatory
- Mechanism: Copper and zinc chelation
- Expression: Neutrophils, inflammatory epidermis
Acid Mantle and pH Regulation
Physiological Acid Mantle Formation
The acid mantle represents critical chemical barrier component that inhibits pathogen growth while supporting beneficial microbiota through precise pH regulation.
pH Regulation Mechanisms:
Sebaceous Lipid Contributions:
- Free fatty acid production: Bacterial lipase activity on triglycerides
- Major fatty acids: Palmitic acid (C16:0), oleic acid (C18:1), linoleic acid (C18:2)
- pKa values: Fatty acids with pKa ~4.5-5.0 buffer skin pH
- Antimicrobial activity: Direct antibacterial and antifungal effects
- Concentration: 15-20% of total sebum composition
Eccrine Sweat Components:
- Lactic acid: Major acidifying component from glucose metabolism
- Pyruvic acid: Additional organic acid contribution
- Amino acids: Histidine, alanine contribute to buffering
- Concentration: 5-25 mM lactic acid depending on activity
- pH effect: Reduces surface pH to 4.5-5.5 range
Epidermal Metabolism:
Filaggrin Degradation Products:
- Histidine: Deiminated to trans-urocanic acid (pKa 6.0)
- Natural moisturizing factors: Include organic acids
- Pyrrolidone carboxylic acid: pH buffering component
- Lactic acid: Metabolic byproduct from keratinocytes
- Clinical significance: Reduced in filaggrin deficiency
Carbonic Anhydrase Systems:
- CA-II expression: Keratinocytes express carbonic anhydrase II
- CO₂ + H₂O ⇌ H⁺ + HCO₃⁻: Provides acid-base regulation
- Buffering capacity: Maintains pH homeostasis
- Regional variation: Different expression across body sites
Antimicrobial Effects of Acidic pH
Low skin pH provides multiple antimicrobial benefits through direct growth inhibition and enhanced antimicrobial peptide activity.
Direct Pathogen Inhibition:
Bacterial Growth Effects:
- Optimal bacterial pH: Most pathogens prefer pH 7.0-7.5
- Growth inhibition: pH <6.0 inhibits many pathogenic bacteria
- S. aureus sensitivity: Reduced growth at pH 5.0-5.5
- P. acnes adaptation: Adapted to acidic follicular environment
- Gram-negative susceptibility: Generally more pH-sensitive
Fungal Sensitivity:
- Candida species: Growth inhibited below pH 6.0
- Dermatophytes: Variable pH sensitivity by species
- Malassezia: Some adaptation to acidic lipid-rich environment
- Clinical correlation: Antifungal effects of acid mantle
pH-Dependent AMP Activity Enhancement:
Defensin Activity Modulation:
- β-defensins: Optimal activity at slightly acidic pH
- Salt sensitivity: Reduced by high salt, enhanced by acidic pH
- Mechanism: Improved membrane binding and pore formation
- Clinical relevance: pH normalization in barrier repair
Dermcidin pH Dependence:
- Optimal activity: pH 5.5-6.5 (physiological sweat pH)
- Mechanism: pH-dependent conformational changes
- Zinc coordination: Enhanced at acidic pH
- Sweat function: Optimized for eccrine secretion conditions
Free Fatty Acid Antimicrobial Activity:
pH-Dependent Partitioning:
- Protonated forms: More membrane-permeable at acidic pH
- Membrane insertion: Enhanced at pH below pKa
- Antimicrobial potency: Increased activity in acidic conditions
- Mechanism: Improved cellular uptake and membrane disruption
Integrated Chemical Defense Networks
Synergistic Antimicrobial Systems
Chemical barrier components function synergistically to create multi-layered defense systems that exceed individual component activities.
AMP Synergism:
LL-37 and β-Defensin Combinations:
- Additive effects: Enhanced antimicrobial activity
- Membrane mechanisms: Different membrane targeting strategies
- Resistance prevention: Reduced likelihood of resistance development
- Clinical application: Combination therapy potential
Metal Ion Coordination:
- Zinc-dependent AMPs: Dermcidin, S100A7, calprotectin
- Competition effects: Zinc availability affects pathogen growth
- Coordination: Multiple AMPs coordinate zinc usage
- Clinical significance: Zinc deficiency impairs chemical barriers
Lipid-AMP Interactions:
Fatty Acid Enhancement:
- Membrane priming: Fatty acids increase AMP membrane binding
- pH optimization: Acidic environment enhances AMP activity
- Resistance prevention: Multiple mechanisms reduce adaptation
- Barrier integration: Chemical and physical barrier coordination
Clinical Applications and Therapeutic Targeting
Understanding chemical barrier mechanisms enables targeted therapeutic interventions for infectious and inflammatory skin diseases.
AMP-Based Therapeutics:
Topical AMP Applications:
- Synthetic peptides: Modified AMPs with enhanced stability
- Delivery systems: Improved penetration and activity
- Resistance advantage: Low resistance development potential
- Clinical development: Multiple peptides in development
pH Restoration Strategies:
- Acidifying agents: Restore physiological skin pH
- Buffering systems: Maintain optimal pH ranges
- Clinical applications: Atopic dermatitis, chronic wounds
- Barrier repair: pH normalization enhances healing
This comprehensive analysis of chemical barrier systems demonstrates the sophisticated biochemical networks that provide antimicrobial protection and barrier homeostasis. Understanding these chemical defense mechanisms is essential for developing targeted therapies for infectious skin diseases and barrier dysfunction disorders.
The next chapter will explore immunological barrier components that provide adaptive immune protection while maintaining tolerance to commensal organisms.
How to Cite
Cutisight. "Antimicrobial Peptides and Acid Mantle." Encyclopedia of Dermatology [Internet]. 2026. Available from: https://cutisight.com/education/volume-02-normal-skin/part-04-skin-barrier/03-chemical-barrier/01-antimicrobial-peptides-and-acid-mantle
This is an open-access resource. Please cite appropriately when using in academic or clinical work.